DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-3 and Brd3

DIOPT Version :9

Sequence 1:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_006233887.1 Gene:Brd3 / 362092 RGDID:1308925 Length:742 Species:Rattus norvegicus


Alignment Length:344 Identity:89/344 - (25%)
Similarity:137/344 - (39%) Gaps:102/344 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SPEINACKVIIKRLFSSTYKNIAWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRLNTGCYLSA 75
            |..:..|..|::.:.|..:...||.||:|:|.:.|.|||||:|::.|||||||:.::::..|..|
  Rat   309 SEHLRHCDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPMDLSTVKRKMDSREYPDA 373

  Fly    76 ADFAKDIRLIFYNTYLYTNPDHLCYHMAKQLQIIFEEMYSQV-------------QLYICSSGSK 127
            ..||.||||:|.|.|.|..|||....||::||.:||..::::             ...|.|.|::
  Rat   374 QGFAADIRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPMEVPALPAPTAPIVSKGAE 438

  Fly   128 -VRAEEESSSDESDSSSPE---------------------------------------------- 145
             .|:.||||||...|.|.|                                              
  Rat   439 SSRSSEESSSDSGSSDSEEERATRLAELQEQTGCGAFQDQLLNVSSVQLKAVHEQLAALSQAPVN 503

  Fly   146 -----------------------------DEVNGSEVSPSIMGAPPSCTPTTECTPTPDWT---- 177
                                         :|...::.:|:...|.....||.:...|...:    
  Rat   504 KPKKKKEKKEKEKKKKDKEKEKEKHKAKSEEEKKAKAAPAAKQAQQKKAPTKKANSTTTASRQLK 568

  Fly   178 -----PPATLETSEQQE--PFTTEEDLDLHAKIQQLDGEVLLHVIHFIQRMEGA--EYCNKELEF 233
                 ..|:.::.|::|  |.:.:|...|...|.:|.||.|..|:|.||..|.:  :....|:|.
  Rat   569 KGGKQASASYDSEEEEEGLPMSYDEKRQLSLDINRLPGEKLGRVVHIIQSREPSLRDSNPDEIEI 633

  Fly   234 DICKLKVHTKRGIRDYLAS 252
            |...||..|.|.:..|:.|
  Rat   634 DFETLKPTTLRELERYVKS 652

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 44/100 (44%)
Brd3XP_006233887.1 Bromo_Brdt_I_like 34..140 CDD:99929
Bromo_Brdt_II_like 311..412 CDD:99930 44/100 (44%)
BET 588..652 CDD:407211 21/63 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000322
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22880
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X197
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.