DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-3 and brd8b

DIOPT Version :9

Sequence 1:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_017214481.1 Gene:brd8b / 337414 ZFINID:ZDB-GENE-030722-10 Length:864 Species:Danio rerio


Alignment Length:167 Identity:45/167 - (26%)
Similarity:80/167 - (47%) Gaps:22/167 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 AWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRLNTGCYLSAADFAKDIRLIFYNTYLYTNPDH 97
            |.||.:|:...:  ...||.||..|||||.::..:.:|...:.|:|.:||.|:|.|..:|.:.||
Zfish   684 ASVFLQPVSDDI--APGYHSIVHRPMDLSAIKKNIESGQIRTTAEFQRDIMLMFQNAVMYNSSDH 746

  Fly    98 LCYHMAKQLQIIFEEMYSQVQLYICSSGSKVRAEEESSSDES---DSSSPEDEVNGSEVSPSIMG 159
            ..||||.::|   .::..|:|.::.:. ..::..|...|.:|   ..::.:.:.|...:||:  .
Zfish   747 DVYHMALEMQ---RDVLEQIQQFLATQ-LIMQTSESGISTKSLRGREANRKQDPNEKTLSPA--H 805

  Fly   160 APPSCTPTTECTPTPDWTPPATLETSEQQEPFTTEED 196
            ..|...|          .|||..:.:..::. |.|:|
Zfish   806 KEPHLEP----------EPPARRKRNNSKQD-TVEKD 831

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 29/80 (36%)
brd8bXP_017214481.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.