DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-3 and fs(1)h

DIOPT Version :9

Sequence 1:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001259321.1 Gene:fs(1)h / 31722 FlyBaseID:FBgn0004656 Length:2046 Species:Drosophila melanogaster


Alignment Length:187 Identity:65/187 - (34%)
Similarity:94/187 - (50%) Gaps:38/187 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAKQETERSSPEINACKVIIKRLFSSTYKNIAWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRH 65
            :|..:..|:.|..:.:|..|:|.|||..:...||.||:|:|.::|||||||:|:::||||.||:.
  Fly   468 VAVAKNKEKLSDALKSCNEILKELFSKKHSGYAWPFYKPVDAEMLGLHDYHDIIKKPMDLGTVKR 532

  Fly    66 RLNTGCYLSAADFAKDIRLIFYNTYLYTNPDHLCYHMAKQLQIIFEEMYSQV------------- 117
            :::...|.||.:||.|:||||.|.|.|..|||....|.::||.:||..|:.:             
  Fly   533 KMDNREYKSAPEFAADVRLIFTNCYKYNPPDHDVVAMGRKLQDVFEMRYANIPDEPVANAAHHHG 597

  Fly   118 ----------------------QLYICSSGSKVRAEEESSSDESDSSSPEDEVNGSE 152
                                  ..|..||..|..|.:.||.|.||:   |:|.|..|
  Fly   598 HGHGHGHGHGHGHGHGHGHGHGHGYGGSSSLKHDASDSSSEDSSDT---ENESNSDE 651

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 47/100 (47%)
fs(1)hNP_001259321.1 Bromo_Brdt_I_like 34..140 CDD:99929
COG5076 387..>593 CDD:227408 51/124 (41%)
Bromo_Brdt_II_like 481..581 CDD:99930 47/99 (47%)
BET 951..1015 CDD:293640
BRD4_CDT <2026..2046 CDD:293710
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000322
OrthoInspector 1 1.000 - - mtm1066
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22880
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X197
65.910

Return to query results.
Submit another query.