DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-3 and Baz1a

DIOPT Version :9

Sequence 1:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_038968148.1 Gene:Baz1a / 314126 RGDID:1306199 Length:1583 Species:Rattus norvegicus


Alignment Length:157 Identity:36/157 - (22%)
Similarity:74/157 - (47%) Gaps:34/157 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KQETERSSP---------------EINACKVIIKRLFSSTYKNIAWVFYEPLDPQLLGLHDYHEI 53
            |:::..|||               |::|.:.::..|   ...:.:|.|.:.:..  :.:.||::|
  Rat  1437 KRQSTESSPVPLNRRSSGRQGGVHELSAFEQLVVEL---VRHDDSWPFLKLVSK--IQVPDYYDI 1496

  Fly    54 VREPMDLSTVRHRLNTGCYLSAADFAKDIRLIFYNTYLYTNPDHLCYHMA-KQLQIIFEEMYSQV 117
            :::|:.|:.:|.::|...|..|::|.:||.|:|.|.:.| ||.:.....| .:||..|.....::
  Rat  1497 IKKPIALNIIREKVNKCEYKLASEFIEDIELMFSNCFEY-NPRNTSEAKAGTRLQAFFHIQAQKL 1560

  Fly   118 QLYICSSGSKVRAEEESSSDESDSSSP 144
            .|::            |.|:...:|:|
  Rat  1561 GLHV------------SPSNVDQASTP 1575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 27/101 (27%)
Baz1aXP_038968148.1 WAC_Acf1_DNA_bd 23..122 CDD:402251
DDT 422..483 CDD:214726
WHIM1 590..635 CDD:406127
PTZ00121 <646..793 CDD:173412
WSD 799..925 CDD:406128
PHD_BAZ1A 1177..1222 CDD:277097
Bromo_Acf1_like 1449..1562 CDD:99936 27/118 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.