DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-3 and Pbrm1

DIOPT Version :9

Sequence 1:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_006252748.1 Gene:Pbrm1 / 306254 RGDID:1565549 Length:1726 Species:Rattus norvegicus


Alignment Length:154 Identity:37/154 - (24%)
Similarity:65/154 - (42%) Gaps:31/154 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RLFSSTYKNIAWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRLNTGCYLSAADFAKDIRLIFY 87
            ||.|..::.:         |..:...||:.|::||:||.|:..|:..|.|.|....||||.|:..
  Rat   223 RLISELFQKL---------PSKVQYPDYYAIIKEPIDLKTIAQRIQNGSYKSIHAMAKDIDLLAK 278

  Fly    88 NTYLYTNPDHLCYHMAKQLQIIFEEMYSQVQLY-ICSSGSKVR-----AEEESSSDESDSSSPED 146
            |...|..|....:..|..::.||....::::.: :..|..::|     |....:....:.||.::
  Rat   279 NAKTYNEPGSQVFKDANSIKKIFYMKKAEIEHHEMTKSSLRIRTATNLAAARLTGPSHNKSSLDE 343

  Fly   147 EVNGSEVSPSIMGAPPSCTPTTEC 170
            |.|                ||::|
  Rat   344 ERN----------------PTSKC 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 27/90 (30%)
Pbrm1XP_006252748.1 Bromo_polybromo_I 65..177 CDD:99954
Bromo_polybromo_II 203..305 CDD:99948 27/90 (30%)
Bromo_polybromo_III 404..505 CDD:99951
Bromo_polybromo_IV 556..659 CDD:99949
Bromo_polybromo_V 695..799 CDD:99946
Bromo_polybromo_VI 812..919 CDD:99956
BAH_polybromo 994..1111 CDD:240068
BAH_polybromo 1192..1310 CDD:240068
HMG-box 1417..1481 CDD:238037
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.