DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-3 and Brdt

DIOPT Version :9

Sequence 1:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001012031.1 Gene:Brdt / 305123 RGDID:1306678 Length:326 Species:Rattus norvegicus


Alignment Length:258 Identity:66/258 - (25%)
Similarity:110/258 - (42%) Gaps:46/258 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KVIIKRLFSSTYKNIAWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRLNTGCYLSAADFAKDI 82
            :|::|.|:..::   :|.|.:|:|...|.|.||:.|:..||||||::.||....|..|::...|.
  Rat    36 RVVLKALWKHSF---SWPFQQPVDAAKLKLPDYYTIIETPMDLSTIKKRLENRYYEKASECVGDF 97

  Fly    83 RLIFYNTYLYTNPDHLCYHMAKQLQIIFEEMYSQVQLYICSSGSKVRAEEE--------SSSDES 139
            ..:|.|.|||..|......||:.|:.:|.:..||:.......|.|.|.:::        |:.:::
  Rat    98 NTMFSNCYLYNKPGDDIVVMAQALEKLFMQKLSQMPQEEQIVGGKERMKKDIQQKTAVSSAKEQT 162

  Fly   140 DSSSPEDEVNGSEV---------SPSIMG--APPSC-------------------TPTTECTPTP 174
            .|.|.|:.....|:         ||..|.  |||:|                   ||||......
  Rat   163 PSKSAENVFKRQEIPAGFPDVCLSPLNMAQEAPPTCDSQTVVQITKGVKRRADTTTPTTSSAKAS 227

  Fly   175 DWTPPATLETSEQQEPFTTEEDLDLHAKIQQLDGEVLLHVIHFIQRMEGAEYCNKELEFDICK 237
            ..:||...|......|  .:|:.   .|....|.:....|:..::..|..::|::.|:..:.|
  Rat   228 SESPPPLREAKPANAP--VKENT---VKSVLPDSQQQHRVLKTVKVTEQLKHCSEILKEMLAK 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 33/95 (35%)
BrdtNP_001012031.1 Bromo_Brdt_I_like 26..132 CDD:99929 34/98 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 141..168 5/26 (19%)
Nuclear localization signal. /evidence=ECO:0000250|UniProtKB:Q58F21 208..219 0/10 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 209..257 11/52 (21%)
Bromodomain 271..>322 CDD:295360 3/15 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000322
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22880
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X197
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.