DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-3 and Kat2a

DIOPT Version :9

Sequence 1:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_006247379.1 Gene:Kat2a / 303539 RGDID:1307242 Length:833 Species:Rattus norvegicus


Alignment Length:93 Identity:28/93 - (30%)
Similarity:43/93 - (46%) Gaps:11/93 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 STYKNI---------AWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRLNTGCYLSAADFAKDI 82
            :|.||:         ||.|.||:...  ...||:|::|.|:||.|:..||.:..|::...|..|:
  Rat   731 TTLKNLLAQIKSHPSAWPFMEPVKKS--EAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADL 793

  Fly    83 RLIFYNTYLYTNPDHLCYHMAKQLQIIF 110
            :.:..|...|..||......|..|:..|
  Rat   794 QRVIANCREYNPPDSEYCRCASALEKFF 821

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 28/93 (30%)
Kat2aXP_006247379.1 PCAF_N 81..330 CDD:283997
COG5076 488..828 CDD:227408 28/93 (30%)
Acetyltransf_1 551..623 CDD:278980
Bromo_gcn5_like 728..827 CDD:99941 28/93 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.