DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-3 and Brd8

DIOPT Version :9

Sequence 1:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_008770251.2 Gene:Brd8 / 291691 RGDID:1307003 Length:1206 Species:Rattus norvegicus


Alignment Length:141 Identity:43/141 - (30%)
Similarity:68/141 - (48%) Gaps:24/141 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 YKNIAWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRLNTGCYLSAADFAKDIRLIFYNTYLYT 93
            |.|   ||.:|:...:  ...||.||:.||||||::..:..|...|.|:|.:||.|:|.|..:|.
  Rat   801 YAN---VFLQPVTDDI--APGYHSIVQRPMDLSTIKKNIENGLIRSTAEFQRDIMLMFQNAVMYN 860

  Fly    94 NPDHLCYHMAKQLQIIFEEMYSQVQLYICS--------SGSKVRAEEESSSDESDSSSPEDEVNG 150
            :.||..||||.::|   .::..|:|.::.:        ||...::.....|.....:|.:|.|. 
  Rat   861 SSDHDVYHMAVEMQ---RDVLEQIQQFLATQLIMQTSESGISAKSLRGRDSTRKQDASEKDSVP- 921

  Fly   151 SEVSPSIMGAP 161
                   ||:|
  Rat   922 -------MGSP 925

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 32/84 (38%)
Brd8XP_008770251.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.