DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-3 and Brd8dc

DIOPT Version :10

Sequence 1:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_808441.2 Gene:Brd8dc / 271508 MGIID:3045347 Length:273 Species:Mus musculus


Alignment Length:103 Identity:35/103 - (33%)
Similarity:58/103 - (56%) Gaps:14/103 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KVIIKRLFSSTYKNIAWVFYEPL-DPQLLGLHDYHEIVREPMDLSTVRHRLNTGCYLSAADFAKD 81
            |:|....|||.       |.:|: :.|..|   |.::|:.||||:|::..|:.|...:.|:|.:|
Mouse   169 KMIASHRFSSP-------FLKPVSEKQAPG---YKDVVKRPMDLTTLKRNLSKGRIHTMAEFQRD 223

  Fly    82 IRLIFYNTYLYTNPDHLCYHMAKQLQIIFEEMYSQVQL 119
            :.|:|.|..:|.:.||..||||.::|   .|:..|:|:
Mouse   224 LMLMFQNAVMYNDSDHHIYHMAVEMQ---REVLEQIQV 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 33/96 (34%)
BET 190..252 CDD:435704
Brd8dcNP_808441.2 Bromo_brd8_like 160..259 CDD:99939 35/103 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.