DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-3 and bdf1

DIOPT Version :9

Sequence 1:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_588301.2 Gene:bdf1 / 2538955 PomBaseID:SPCC1450.02 Length:578 Species:Schizosaccharomyces pombe


Alignment Length:277 Identity:63/277 - (22%)
Similarity:122/277 - (44%) Gaps:17/277 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KQETERSSPEINACKVIIKRLFSSTYKNIAWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRLN 68
            |....:::.::..|..::|.|:...|::.|:.||:|:||......||.::::|||||||::.:||
pombe   247 KPRRRKNNSQMRFCSTVLKELYKRQYESFAFPFYQPVDPVACDCPDYFDVIKEPMDLSTIQSKLN 311

  Fly    69 TGCYLSAADFAKDIRLIFYNTYLYTNPDHLCYHMAKQLQIIFEEMYSQVQLYICSSGSKVRAEEE 133
            ...|.:..:|..||.|:|.|.:.|..|....:.|.:||:.:|:|.:.....:  ...:.|:.:|.
pombe   312 KNEYSTLEEFESDILLMFNNCFTYNPPGTPVHVMGRQLENVFKEKWEARPKF--DDATLVKQQEA 374

  Fly   134 ------SSSDESDSSSPEDEVNGSEVSPSIMGAPPSCTPTTECTPTPDWT---PPATLETSEQQE 189
                  .:.:|.::...|:|:||::.: ::.........|.|........   .|...:.:::..
pombe   375 ETDALFDNGEEEEALMSEEEINGAKFA-AVDKQISMLQDTLEAMKAKKMNRMRKPRRRDLTKEYG 438

  Fly   190 PFTTEEDLDLHAKIQQLDGEVLLHVIHFIQRMEGAEYCNKELEFDICKLKVHTKRGIRDYLASKG 254
            |.|.....:|..:...|..|.|.:|...::..........|:|.|:..:|......|..|:....
pombe   439 PITYAMQNELAERCNYLSAEQLSNVAEILREEMPWLRDTDEIEIDVGNMKPEVFHRIYRYVCKPD 503

  Fly   255 FTGKRVAR-----TKPK 266
            ......|.     |||:
pombe   504 ADSSEPASPVLMPTKPE 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 35/100 (35%)
bdf1NP_588301.2 Bromo_BDF1_2_I 85..187 CDD:99932
Bromo_Brdt_II_like 256..357 CDD:99930 35/100 (35%)
BET 439..501 CDD:293640 13/61 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000322
OrthoInspector 1 1.000 - - mtm9296
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22880
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X197
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.