| Sequence 1: | NP_726307.1 | Gene: | tbrd-3 / 246604 | FlyBaseID: | FBgn0050417 | Length: | 268 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001300353.1 | Gene: | bet-2 / 181257 | WormBaseID: | WBGene00010199 | Length: | 1209 | Species: | Caenorhabditis elegans |
| Alignment Length: | 358 | Identity: | 66/358 - (18%) |
|---|---|---|---|
| Similarity: | 111/358 - (31%) | Gaps: | 144/358 - (40%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 17 CKVIIKRLFSSTYKNIAWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRLNTGCYLSAADFAKD 81
Fly 82 IRLIFYNTYLYTNPDHLCYHMAKQLQIIFEEMY------------------------------SQ 116
Fly 117 VQLYICSSGSKVRAEEESSSDE------------------------------------------- 138
Fly 139 ---------------------SDSSSPE----DEVNGSEVSPSIMGAPPSCTPTTECTP-TPDWT 177
Fly 178 P-----------------PATL-ETSEQQEPFT--------------TEEDLDLH---AKIQQLD 207
Fly 208 GEVLLHVIHFIQRMEG------AEYCNKELEFD 234 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| tbrd-3 | NP_726307.1 | Bromo_Brdt_II_like | 13..114 | CDD:99930 | 31/96 (32%) |
| bet-2 | NP_001300353.1 | Bromodomain | 282..388 | CDD:295360 | |
| COG5076 | 429..>661 | CDD:227408 | 31/100 (31%) | ||
| Bromo_Brdt_II_like | 556..657 | CDD:99930 | 31/96 (32%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0000322 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR22880 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X197 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 4 | 4.010 | |||||