DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment tbrd-3 and baz-2

DIOPT Version :9

Sequence 1:	NP_726307.1	Gene:	tbrd-3 / 246604	FlyBaseID:	FBgn0050417	Length:	268	Species:	Drosophila melanogaster
Sequence 2:	NP_498673.3	Gene:	baz-2 / 176078	WormBaseID:	WBGene00001470	Length:	1390	Species:	Caenorhabditis elegans

Alignment Length:	111	Identity:	32/111 - (28%)
Similarity:	52/111 - (46%)	Gaps:	26/111 - (23%)

- Green bases have known domain annotations that are detailed below.

  Fly    17 CKVIIKRLFSSTYKNIAWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRLNTGCYLSAADFAKD 81
            |::::..|   ..:..|..|.||::|:|  :..|..|:.:||||.|:|.:.....|.:..|||:|
Worm  1282 CQLMLDEL---VVQANALPFLEPVNPKL--VPGYKMIISKPMDLKTIRQKNEKLIYETPEDFAED 1341

  Fly    82 IRLIFYNTYLYTNPDH--------------------LCYHMAKQLQ 107
            |.|:|.|...: |.||                    |.|:..|:|:
Worm  1342 IELMFANCRQF-NIDHSEIGRAGISLHKFFQKRWKQLKYNFTKRLR 1386

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
tbrd-3	NP_726307.1	Bromo_Brdt_II_like	13..114	CDD:99930	32/111 (29%)
baz-2	NP_498673.3	FlgD	35..88	CDD:281896
		HAT_MBD	328..401	CDD:238691
		DDT	524..>564	CDD:295426
		WHIM1	622..670	CDD:292246
		WHIM3	899..931	CDD:292248
		PHD_BAZ2A_like	1102..1146	CDD:277020
		PHD	1155..1199	CDD:214584
		Bromo_BAZ2A_B_like	1278..1374	CDD:99935	28/97 (29%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5076
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900