DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-3 and ZK1010.10

DIOPT Version :9

Sequence 1:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001255185.1 Gene:ZK1010.10 / 13191684 WormBaseID:WBGene00164985 Length:194 Species:Caenorhabditis elegans


Alignment Length:102 Identity:22/102 - (21%)
Similarity:36/102 - (35%) Gaps:48/102 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 HEIVREPMDLSTVRHRLNTGCYLSAADFAKDIRLIFYNTYLYTNPDHLCYHMAKQLQIIFEEMYS 115
            ||| |:.|:      ..:.|.|                 :|| :.|||.:.:.::||.:      
 Worm   119 HEI-RDAME------TYSAGSY-----------------HLY-DLDHLVHRVVRRLQDL------ 152

  Fly   116 QVQLYICSSGSKVRAEEESSSDESDSSSPEDEVNGSE 152
                          :.::..|||.|.   |.||.|.:
 Worm   153 --------------SPDQQLSDEEDG---EAEVAGDQ 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 14/62 (23%)
ZK1010.10NP_001255185.1 zf-TAZ 55..115 CDD:366931
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.