powered by:
Protein Alignment tbrd-3 and ZK1010.10
DIOPT Version :9
Sequence 1: | NP_726307.1 |
Gene: | tbrd-3 / 246604 |
FlyBaseID: | FBgn0050417 |
Length: | 268 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001255185.1 |
Gene: | ZK1010.10 / 13191684 |
WormBaseID: | WBGene00164985 |
Length: | 194 |
Species: | Caenorhabditis elegans |
Alignment Length: | 102 |
Identity: | 22/102 - (21%) |
Similarity: | 36/102 - (35%) |
Gaps: | 48/102 - (47%) |
- Green bases have known domain annotations that are detailed below.
Fly 51 HEIVREPMDLSTVRHRLNTGCYLSAADFAKDIRLIFYNTYLYTNPDHLCYHMAKQLQIIFEEMYS 115
||| |:.|: ..:.|.| :|| :.|||.:.:.::||.:
Worm 119 HEI-RDAME------TYSAGSY-----------------HLY-DLDHLVHRVVRRLQDL------ 152
Fly 116 QVQLYICSSGSKVRAEEESSSDESDSSSPEDEVNGSE 152
:.::..|||.|. |.||.|.:
Worm 153 --------------SPDQQLSDEEDG---EAEVAGDQ 172
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
tbrd-3 | NP_726307.1 |
Bromo_Brdt_II_like |
13..114 |
CDD:99930 |
14/62 (23%) |
ZK1010.10 | NP_001255185.1 |
zf-TAZ |
55..115 |
CDD:366931 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5076 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.