DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-3 and Brdt

DIOPT Version :9

Sequence 1:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_006534791.1 Gene:Brdt / 114642 MGIID:1891374 Length:961 Species:Mus musculus


Alignment Length:324 Identity:83/324 - (25%)
Similarity:138/324 - (42%) Gaps:65/324 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ETERSSPEINACKVIIKRLFSSTYKNIAWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRLNTG 70
            :|.:.:.::..|..|:|.:.:..:...||.||.|:|...||||:|:::|:.||||.|::.:::..
Mouse   264 KTVKVTEQLKHCSEILKEMLAKKHLPYAWPFYNPVDADALGLHNYYDVVKNPMDLGTIKGKMDNQ 328

  Fly    71 CYLSAADFAKDIRLIFYNTYLYTNPDHLCYHMAKQLQIIFEEMYSQV------QLYIC--SSGSK 127
            .|..|.:||.|:||:|.|.|.|..|||....||:.||.:||..::::      .::.|  ::.|.
Mouse   329 EYKDAYEFAADVRLMFMNCYKYNPPDHEVVAMARTLQDVFELHFAKIPDEPIESMHACHLTTNSA 393

  Fly   128 VRAEEESSSDES--DSSSPEDE-------------VNGSEVSPSIMGAPP-----------SCTP 166
            .....||||:.|  |:||.:.|             :|.......::...|           ...|
Mouse   394 QALSRESSSEASSGDASSEDSEDERVQHLAKLQEQLNAVHQQLQVLSQVPLRKLKKKNEKSKRAP 458

  Fly   167 TTECTPTPDWTPPATLETSEQQE-----------------------PFTTEEDLDLHAKIQQLDG 208
            ..:.....|..|....:..:|:|                       |...:|...|...|.:|.|
Mouse   459 KRKKVNNRDENPRKKPKQMKQKEKAKINQPKKKKPLLKSEEEDNAKPMNYDEKRQLSLDINKLPG 523

  Fly   209 EVLLHVIHFIQRMEGAEYCNK--ELEFDICKLKVHTKRGIRDYL------ASKGFTGKRVARTK 264
            :.|..::|.||..|.:...:.  |:|.|...||..|.|.:..|:      .|.....|:|.|:|
Mouse   524 DKLGRIVHIIQSREPSLRNSNPDEIEIDFETLKASTLRELEKYVLACLRKRSLKPQAKKVVRSK 587

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 40/100 (40%)
BrdtXP_006534791.1 Bromo_Brdt_I_like 26..132 CDD:99929
Bromo_Brdt_II_like 271..372 CDD:99930 40/100 (40%)
BET 505..567 CDD:374956 18/61 (30%)
BRD4_CDT 919..961 CDD:374989
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000322
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22880
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X197
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.