DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-3 and BAZ2A

DIOPT Version :9

Sequence 1:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_011536103.1 Gene:BAZ2A / 11176 HGNCID:962 Length:1912 Species:Homo sapiens


Alignment Length:113 Identity:36/113 - (31%)
Similarity:58/113 - (51%) Gaps:15/113 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EINACKVIIKRLFSSTYKNIAWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRLNTGCYLSAAD 77
            ::..|::|:..:.|   .:.||.|.||::|:|:.  .|..|::.|||.||:|.||..|.|.|:.:
Human  1805 DLTFCEIILMEMES---HDAAWPFLEPVNPRLVS--GYRRIIKNPMDFSTMRERLLRGGYTSSEE 1864

  Fly    78 FAKDIRLIFYNTYLYTNPD-------HLCYHMAKQLQIIFEEMYSQVQ 118
            ||.|..|:|.|...:...|       |:   |.:..:..:||.|...|
Human  1865 FAADALLVFDNCQTFNEDDSEVGKAGHI---MRRFFESRWEEFYQGKQ 1909

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 34/107 (32%)
BAZ2AXP_011536103.1 HAT_MBD 551..623 CDD:238691
DDT 848..913 CDD:214726
WHIM3 1439..1477 CDD:292248
PHD_BAZ2A 1685..1731 CDD:277099
Bromo_BAZ2A_B_like 1805..1901 CDD:99935 32/103 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.