DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-3 and baz2bb

DIOPT Version :10

Sequence 1:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_073769351.1 Gene:baz2bb / 100536981 ZFINID:ZDB-GENE-130826-2 Length:1988 Species:Danio rerio


Alignment Length:95 Identity:30/95 - (31%)
Similarity:51/95 - (53%) Gaps:7/95 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KQETER-SSPEINACKVIIKRLFSSTYKNIAWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRL 67
            |||..| .|.::..|::::..|..   ...|..|..|::|:  .:..|.:|:::|||.||:|.:|
Zfish  1867 KQEKHRDDSKDLALCRILLAELEG---HQEAGPFLTPVNPK--SVPGYRKIIKKPMDFSTIRDKL 1926

  Fly    68 NTGCYLSAADFAKDIRLIFYNTYLYTNPDH 97
            .:..||:...|..|:.|:|.|...: |.||
Zfish  1927 ASSQYLNLETFIIDVNLVFDNCEKF-NEDH 1955

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 25/85 (29%)
BET 190..252 CDD:435704
baz2bbXP_073769351.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.