DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-3 and baz2a

DIOPT Version :9

Sequence 1:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_002934572.1 Gene:baz2a / 100126219 XenbaseID:XB-GENE-965900 Length:1695 Species:Xenopus tropicalis


Alignment Length:93 Identity:35/93 - (37%)
Similarity:54/93 - (58%) Gaps:5/93 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KQETERSSPEINACKVIIKRLFSSTYKNIAWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRLN 68
            :..|...||::..|::|:..|.|   ...||.|.||::|:|  :..|.:|::.|||.||:||:|.
 Frog  1578 RMATRSHSPDLTFCEIILMELES---HEDAWPFLEPVNPRL--VPGYRKIIKNPMDFSTIRHKLL 1637

  Fly    69 TGCYLSAADFAKDIRLIFYNTYLYTNPD 96
            .|.|.|..:||:|..|:|.|..|:...|
 Frog  1638 NGKYSSCEEFAEDAELVFSNCQLFNEDD 1665

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 32/84 (38%)
baz2aXP_002934572.1 HAT_MBD 424..496 CDD:238691
DDT 699..757 CDD:367184
WSD 951..>978 CDD:373967
WSD <1233..1269 CDD:373967
PHD_BAZ2A 1475..1521 CDD:277099
Bromo_BAZ2A_B_like 1587..1683 CDD:99935 32/84 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.