DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-3 and baz1b

DIOPT Version :9

Sequence 1:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_002933656.2 Gene:baz1b / 100038181 XenbaseID:XB-GENE-853544 Length:1436 Species:Xenopus tropicalis


Alignment Length:93 Identity:28/93 - (30%)
Similarity:50/93 - (53%) Gaps:5/93 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AKQETERSSPEINACKVIIKRLFSSTYKNIAWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRL 67
            :|..:.|.:.|:..|:.|:.:|....:   :|.|.||::..  .:.||..:|..|||..|::.:.
 Frog  1294 SKPTSRRQNQELQKCEEILAKLIKYRF---SWPFREPVNTD--EIEDYMNVVTNPMDFQTMQSKC 1353

  Fly    68 NTGCYLSAADFAKDIRLIFYNTYLYTNP 95
            :.|.|.:..:|..|::|:|.||.||..|
 Frog  1354 SCGSYQTVQEFLNDLKLVFGNTELYYEP 1381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 26/83 (31%)
baz1bXP_002933656.2 WAC_Acf1_DNA_bd 28..126 CDD:402251
PTZ00121 <457..863 CDD:173412
WHIM1 696..741 CDD:406127
tolA <737..>865 CDD:236545
WSD 868..990 CDD:406128
PHD_BAZ1B 1152..1197 CDD:277098
Bromo_WSTF_like 1304..1400 CDD:99937 26/83 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.