DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment roh and roh

DIOPT Version :10

Sequence 1:NP_726318.1 Gene:roh / 246602 FlyBaseID:FBgn0250838 Length:82 Species:Drosophila melanogaster
Sequence 2:XP_311195.5 Gene:roh / 1272441 VectorBaseID:AGAMI1_012811 Length:76 Species:Anopheles gambiae


Alignment Length:73 Identity:52/73 - (71%)
Similarity:60/73 - (82%) Gaps:0/73 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PAGRPMRYPYTFSAKIAQFPIKHYIKNQWIWRYYFIAAVACVPVFYKISKLANSPENKKAWAESQ 74
            |..|||::|||||||:|||||:||.||||||||||||....:|:||||.||||||.|:..||||:
Mosquito     4 PVARPMKFPYTFSAKLAQFPIQHYFKNQWIWRYYFIAFGVSIPLFYKIHKLANSPANQAKWAESK 68

  Fly    75 AKEHAEHH 82
            .|||.|||
Mosquito    69 RKEHEEHH 76

Return to query results.
Submit another query.