DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30413 and CG13323

DIOPT Version :10

Sequence 1:NP_726308.1 Gene:CG30413 / 246601 FlyBaseID:FBgn0050413 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_610832.1 Gene:CG13323 / 36433 FlyBaseID:FBgn0033788 Length:112 Species:Drosophila melanogaster


Alignment Length:126 Identity:29/126 - (23%)
Similarity:40/126 - (31%) Gaps:35/126 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VFLLLVGTHVCFIDANFGSGEGNDYTYGTQATTDTLIASETITKSKSLLGITTKTYTLTQ----- 65
            |..:::|.|.  ..|.:|....|||                      ||..||:.....:     
  Fly    10 VLAVILGCHA--YGATWGRRNNNDY----------------------LLSRTTEVRNPIKNNYWN 50

  Fly    66 ------AGTAKTITYIKITDLKKMRGATAEITSGGVGSTTVTIKFTSARGAGIKSQVVIYG 120
                  ||.......|...:.|...||:..:.|||.|....|:........||.|.|.|:|
  Fly    51 VNVNYPAGFYNISAVIVYDNFKNNSGASPSLYSGGPGYRFATVNLRGQVNRGINSTVEIWG 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30413NP_726308.1 MBF2 32..120 CDD:464913 20/98 (20%)
CG13323NP_610832.1 MBF2 24..111 CDD:464913 24/108 (22%)

Return to query results.
Submit another query.