DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpi and RSW10

DIOPT Version :9

Sequence 1:NP_001246480.1 Gene:Rpi / 246599 FlyBaseID:FBgn0050410 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_177266.1 Gene:RSW10 / 843450 AraportID:AT1G71100 Length:267 Species:Arabidopsis thaliana


Alignment Length:232 Identity:86/232 - (37%)
Similarity:134/232 - (57%) Gaps:14/232 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDDIALDAAKKTAARTAVDQWVTEDTKILGIGSGSTVVYAVQRIAERVWKEGELTDLICVPSSYQ 65
            :.::..:..||.||..||:  ..|...::|:|:|||..:||.||:| :.:||:|.|:|.:|:|..
plant    24 LSNLTQEELKKIAAYKAVE--FVESGMVIGLGTGSTAKHAVARISE-LLREGKLKDIIGIPTSTT 85

  Fly    66 ARHLILDYNLNLGDLDRNPNIDVAIDGADEVDRHMVLIKGGGGCLLQEKVVASCAKHFIVVADYT 130
            .....:...:.|.|||.:|.:|::||||||||..:.|:||.||.||:||::...:|.|:|:.|.:
plant    86 THEQAVSLGIPLSDLDSHPVVDLSIDGADEVDPALNLVKGRGGSLLREKMIEGASKKFVVIVDES 150

  Fly   131 KNSIRLGEQWCRGVPIEVAPMAYVPIKLHIEALF---GGEASLRMAKV-----KAGPIVTDNGNF 187
            |....:|.... .||:||.|......:..:|.||   |..|.||| |:     :|.|.||||.|:
plant   151 KLVKYIGGSGL-AVPVEVVPFCCDFTRGKLEELFRDSGCVAKLRM-KIGSNGEEAAPAVTDNRNY 213

  Fly   188 LLDWKFIANREYDWDEVNRAITLIPGVLETGLFVNMA 224
            ::| .::.....|.:..:.||...|||:|.|:|:.||
plant   214 VVD-LYLERDIGDLEVASEAILRFPGVVEHGMFLGMA 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpiNP_001246480.1 RPI_A 24..231 CDD:238692 80/209 (38%)
RSW10NP_177266.1 PLN02384 1..265 CDD:215215 86/232 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 105 1.000 Domainoid score I2208
eggNOG 1 0.900 - - E1_COG0120
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6943
Inparanoid 1 1.050 137 1.000 Inparanoid score I1816
OMA 1 1.010 - - QHG60821
OrthoDB 1 1.010 - - D1074761at2759
OrthoFinder 1 1.000 - - FOG0002439
OrthoInspector 1 1.000 - - otm3536
orthoMCL 1 0.900 - - OOG6_101105
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1856
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.740

Return to query results.
Submit another query.