DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpi and AT5G44520

DIOPT Version :9

Sequence 1:NP_001246480.1 Gene:Rpi / 246599 FlyBaseID:FBgn0050410 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001331391.1 Gene:AT5G44520 / 834479 AraportID:AT5G44520 Length:326 Species:Arabidopsis thaliana


Alignment Length:242 Identity:63/242 - (26%)
Similarity:111/242 - (45%) Gaps:30/242 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AARTAVDQWVTEDTKILGIGSGSTVVYAVQRIAERVWKEGELTDLICVPSSYQARHLILDYNLNL 77
            ||...||.:| :...|:|:|||....:|::.:.::: ..|.|.:::.||.|.::......|.:.|
plant    73 AAHHTVDNYV-KSGMIIGLGSGEASDFAIRYLGQQL-GSGSLHNVVGVPMSARSASEAAKYGIPL 135

  Fly    78 GDLDRNPNIDVAIDGADEVDRHMVLIKGGGGCLLQEKVVASCAKHFIVVADYTKNSIRLGEQWCR 142
            ........||.|...||.|:.:.::...|.....||.......|..:.|||.....|: .||:..
plant   136 EYYRDGVQIDFAFHDADAVEENTLIAVIGRRRSSQEDDYILKQKSIVKVADEAVFMIK-EEQYKA 199

  Fly   143 G----VPIEVAPMAYVPIKLHIEALFGGEASL-RMAKVK-----AG--PIVTDNGNFLLDWKF-- 193
            |    :|:.|..:.::.|...|:.|:.|:|.: |.|.|:     .|  ||||.:|:.:||..|  
plant   200 GLEGSIPVLVQSLNWLAIAEEIDDLYLGDAEVWRRASVENEGPLGGDFPIVTSDGHNILDVIFTT 264

  Fly   194 ----IANREYDWDEVNRAITLIPGVLETGLFVNMAHKCYYGMANGSV 236
                :|:.....|:::       ||::.||.:..  :|...:|..:|
plant   265 PIRSLADLATSLDKID-------GVVDHGLIIKT--RCTVVIAEETV 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpiNP_001246480.1 RPI_A 24..231 CDD:238692 56/224 (25%)
AT5G44520NP_001331391.1 RPI_A 72..299 CDD:238692 61/237 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0120
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002439
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.