DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango11 and MFF

DIOPT Version :9

Sequence 1:NP_726111.1 Gene:Tango11 / 246596 FlyBaseID:FBgn0050404 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001263990.1 Gene:MFF / 56947 HGNCID:24858 Length:342 Species:Homo sapiens


Alignment Length:330 Identity:83/330 - (25%)
Similarity:142/330 - (43%) Gaps:97/330 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DAKYAHEINDKMRVPKRIKATGEYSNEDLLLSNQNGMISSWNYHDKIDMNVPDRIVVLGHNQHLE 85
            :.:|...|:.:||||:::|...  .|.||....|.|:.::     .:.|.||:||||.|:|:.: 
Human    36 EMEYTEGISQRMRVPEKLKVAP--PNADLEQGFQEGVPNA-----SVIMQVPERIVVAGNNEDV- 92

  Fly    86 TRSAPREIQLENSILPKNPSVGLVRVQTPPRIITLT-------DQHFPSASEESSPIRANGHHLY 143
            :.|.|.::.|..| .|..|    :.::||||::||:       |...|..:.::..|||.|....
Human    93 SFSRPADLDLIQS-TPFKP----LALKTPPRVLTLSERPLDFLDLERPPTTPQNEEIRAVGRLKR 152

  Fly   144 GNDLDEDA---------DDEEVHATQYVRANGVARMGFQ-------------------------- 173
            ...:.|:|         :|...|.:.....|.::|  ||                          
Human   153 ERSMSENAVRQNGQLVRNDSLWHRSDSAPRNKISR--FQAPISAPEYTVTPSPQQARVCPPHMLP 215

  Fly   174 --GNDTNS-------VESDSQ-----------------LTTGSASKRSQLNQQQHN------NLD 206
              |.:.:|       ::|.::                 |..|||:..|  |....|      |:|
Human   216 EDGANLSSARGILSLIQSSTRRAYQQILDVLDENRRPVLRGGSAAATS--NPHHDNVRYGISNID 278

  Fly   207 ASMLAHREGTPMGELTPHEEILYLRRQLAKLNRRVLNIEINNEQRTQREKIVYCLGLAYFVLKTI 271
            .::    ||| ..:||. .:...||||:.|||||:..:|..|::|.:||.::|.:.:|:::|.:.
Human   279 TTI----EGT-SDDLTV-VDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSW 337

  Fly   272 FWLNR 276
            .|..|
Human   338 LWFRR 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango11NP_726111.1 Miff 15..276 CDD:283332 82/328 (25%)
MFFNP_001263990.1 Miff 27..342 CDD:283332 82/328 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151687
Domainoid 1 1.000 51 1.000 Domainoid score I11633
eggNOG 1 0.900 - - E1_2929X
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I5470
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1383657at2759
OrthoFinder 1 1.000 - - FOG0007339
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107502
Panther 1 1.100 - - O PTHR16501
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5455
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.760

Return to query results.
Submit another query.