DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango11 and mff-2

DIOPT Version :9

Sequence 1:NP_726111.1 Gene:Tango11 / 246596 FlyBaseID:FBgn0050404 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001370753.1 Gene:mff-2 / 3565409 WormBaseID:WBGene00018894 Length:161 Species:Caenorhabditis elegans


Alignment Length:245 Identity:53/245 - (21%)
Similarity:82/245 - (33%) Gaps:92/245 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 MRVPKRIKATGEYSNEDLLLSNQNGMISSWNYHDKID-MNVPDRIVVLGHNQHLETRSAPREIQL 95
            |.||:.|.|||     |.:..:..|.....|....:: |.|||||.|.|.:.:.......|    
 Worm     1 MFVPEHITATG-----DEMRGHGGGPSRRTNRQSLVEQMEVPDRITVTGGDTYGRITEDYR---- 56

  Fly    96 ENSILPKNPSVGLVRVQTPPRIITLTDQHFPSASEESSPIRANGHHLYGNDLDEDADDEEVHATQ 160
             ||: .|.|:.....:...|.::|:.|..:|...:..                            
 Worm    57 -NSV-DKLPTENAHYLTDVPDVLTVADTQYPVEDQRR---------------------------- 91

  Fly   161 YVRANGVARMGFQGNDTNSVESDSQLTTGSASKRSQLNQQQHNNLDASMLAHREGTPMGELTPHE 225
                                |.|:..|                  |:||:...:        |..
 Worm    92 --------------------ELDTART------------------DSSMVVDED--------PLR 110

  Fly   226 EILYLRRQLAKLNRRVLNIEINNEQRTQREKIVY--CLGLAYFVLKTIFW 273
            |:..||||:.:::.||..:|..||.|..||:.::  .||:|.    |.||
 Worm   111 ELKMLRRQMGRISARVFELEEKNETRRHREQAIFVALLGVAI----TAFW 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango11NP_726111.1 Miff 15..276 CDD:283332 53/245 (22%)
mff-2NP_001370753.1 Miff <105..160 CDD:398976 20/64 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162123
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1383657at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR16501
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.