DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango11 and mff

DIOPT Version :9

Sequence 1:NP_726111.1 Gene:Tango11 / 246596 FlyBaseID:FBgn0050404 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_004917872.1 Gene:mff / 100379850 XenbaseID:XB-GENE-5870242 Length:304 Species:Xenopus tropicalis


Alignment Length:310 Identity:69/310 - (22%)
Similarity:124/310 - (40%) Gaps:81/310 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DAKYAHEINDKMRVPKRIKATGEYSNEDLLLSNQNGMISSWNYHDKIDMNVPDRIVVLGHNQHLE 85
            :.:|...|:.:||||:::|.....|..|..:.....:       ..:.|.||:||||.|||:. .
 Frog    22 EIEYTEGISQRMRVPEKLKVAPSNSGVDPKVQPDMSL-------PGVMMEVPERIVVAGHNEE-S 78

  Fly    86 TRSAPREIQLENSILPKNPSVGLVRVQTPPRIITLTDQ------------------------HFP 126
            ..|.|.::    ..:| ..::..:.::||||::||:::                        |..
 Frog    79 PFSRPSDL----DFIP-GTNIETLALKTPPRVLTLSERPLDFLDLEGSTPATPHNEEVRSSVHLK 138

  Fly   127 S---ASEESSPIRANGHHLYGNDLDE---------DADDEEVHATQYVRANGV-------ARMGF 172
            .   |||  :|:|.||..:..:.:..         .|............|.|:       .|..:
 Frog   139 KERLASE--NPLRQNGQLVRHDSIPTPSAPAGRLCPAPSPPAVGADLFSARGILSLIQTSTRRAY 201

  Fly   173 QGNDTNSVESDSQLTTGSASKRSQLNQQQHNN-------LDASMLAHREGTPMGELTPHE----E 226
            |.......|:...:..|.:|..:.:.  .|:|       |||::          :.||.:    :
 Frog   202 QQVLDVLDENRRPILRGGSSNSAPVT--HHDNPRSAMSTLDATL----------DATPDDLALAD 254

  Fly   227 ILYLRRQLAKLNRRVLNIEINNEQRTQREKIVYCLGLAYFVLKTIFWLNR 276
            ...||||:.|||||:|.:|..|::|.:.|..:|.:.:.:.:|.:..|..|
 Frog   255 AASLRRQIIKLNRRLLLLEEENKERVKHEMTMYSIIIIFGLLNSWLWFRR 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango11NP_726111.1 Miff 15..276 CDD:283332 68/308 (22%)
mffXP_004917872.1 Miff 13..304 CDD:398976 68/308 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10642
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I5239
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1383657at2759
OrthoFinder 1 1.000 - - FOG0007339
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR16501
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5455
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.160

Return to query results.
Submit another query.