DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango11 and LOC100000713

DIOPT Version :9

Sequence 1:NP_726111.1 Gene:Tango11 / 246596 FlyBaseID:FBgn0050404 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001373208.1 Gene:LOC100000713 / 100000713 -ID:- Length:287 Species:Danio rerio


Alignment Length:308 Identity:66/308 - (21%)
Similarity:118/308 - (38%) Gaps:87/308 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SDAKYAHEINDKMRVPKRIKA-----TGEYSN----EDLLLSNQNGMISSWNYHDKIDMNVPDRI 75
            ||..:...||.|||||:|::.     |.|:.:    |||..:              ..|::|||:
Zfish    16 SDPYFTEVINKKMRVPERLRVGPTAQTAEHVHPRPAEDLPAA--------------YSMHIPDRL 66

  Fly    76 VVLG---------HNQHLET----------RSAPREIQLENSILPKNPSVGLVRV---------- 111
            .:..         .::|..:          |.|.|| .:::.:.......|..|.          
Zfish    67 ALTDAPDLSPRPLFSKHTSSMWDVHQGSWDREAFRE-PVQSPLRRSYSDQGFGRTPPGTPTHSRQ 130

  Fly   112 ----QTPPRI----ITLTDQHFPSASEESSPIRANGHHLYGNDLDEDADDEEVHAT----QYVRA 164
                |||..:    :||:   .||.::...|.....:.|....:.:.|.:....|:    |.|..
Zfish   131 TAYSQTPRSVGRPPVTLS---APSQTKPPGPPSIPPNLLSPQSILQAARELGQQASQRLLQSVTQ 192

  Fly   165 NGVARMGFQGN-DTNSVESDSQLTTGSASKRSQLNQQQHNNLDASMLAHREGTPMGELTPHEEIL 228
            ...:|.|:..| .:.:||.....:..|..:...|:.::    ||       ||.:       |.:
Zfish   193 KYSSRFGYPENRPSQAVEVQPDQSRTSVQQEVWLSPEE----DA-------GTAV-------EFM 239

  Fly   229 YLRRQLAKLNRRVLNIEINNEQRTQREKIVYCLGLAYFVLKTIFWLNR 276
            .||||:.|::||:..:|..:.:..|.|.:::.|.::..:|....||.|
Zfish   240 VLRRQVVKMSRRIAGLERQSAEHRQTELLLFSLLVSACLLNGWLWLRR 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango11NP_726111.1 Miff 15..276 CDD:283332 65/306 (21%)
LOC100000713NP_001373208.1 Miff 17..287 CDD:398976 64/305 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR16501
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.