DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30403 and Dyro

DIOPT Version :10

Sequence 1:NP_726108.3 Gene:CG30403 / 246595 FlyBaseID:FBgn0050403 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001261708.1 Gene:Dyro / 39271 FlyBaseID:FBgn0036152 Length:569 Species:Drosophila melanogaster


Alignment Length:98 Identity:26/98 - (26%)
Similarity:48/98 - (48%) Gaps:22/98 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FSDERTVKFVELYGREPCLWN---KRPYLRRARSAAYRRIQSGINADIEPYESGLTIQGVKMKIK 77
            :|....:.|:|.|.|:..||:   |..::::.:..|.:.:..         :.|..|:.::.|||
  Fly    56 WSRSTILNFIEDYRRQRVLWDPNTKGYHIKQTKYEALKLLSQ---------KYGTEIRSIRSKIK 111

  Fly    78 NLRTGYHQELKKIRTIPG------YQPKTPWFA 104
            :||:.:|:|..|:  :.|      |||.  |||
  Fly   112 SLRSSFHREHGKV--LSGRNRGVIYQPM--WFA 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30403NP_726108.3 MADF_DNA_bdg 24..103 CDD:463144 22/87 (25%)
DyroNP_001261708.1 MADF_DNA_bdg 64..147 CDD:463144 25/90 (28%)

Return to query results.
Submit another query.