DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30403 and CG33017

DIOPT Version :10

Sequence 1:NP_726108.3 Gene:CG30403 / 246595 FlyBaseID:FBgn0050403 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_788375.1 Gene:CG33017 / 36811 FlyBaseID:FBgn0053017 Length:1630 Species:Drosophila melanogaster


Alignment Length:42 Identity:13/42 - (30%)
Similarity:19/42 - (45%) Gaps:11/42 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GPAHKLSANH--------YVIRDARREVA---PPIDLTTQKL 78
            |.|...||||        ::|.:.|..|.   ..||:.:||:
  Fly    34 GMAGLSSANHLAKNGCTDFLILEGRNRVGGRIVSIDMGSQKI 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30403NP_726108.3 MADF_DNA_bdg 24..103 CDD:463144 13/42 (31%)
CG33017NP_788375.1 MADF_DNA_bdg 21..106 CDD:463144 13/42 (31%)
PTZ00108 <580..830 CDD:240271
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.