DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30403 and CG5953

DIOPT Version :9

Sequence 1:NP_726108.3 Gene:CG30403 / 246595 FlyBaseID:FBgn0050403 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001260503.1 Gene:CG5953 / 34985 FlyBaseID:FBgn0032587 Length:701 Species:Drosophila melanogaster


Alignment Length:97 Identity:23/97 - (23%)
Similarity:41/97 - (42%) Gaps:19/97 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FSDERTVKFVELYGREPCLWNK-----RPYLRRARSAAYRRIQSGINADIEPYESGLTIQGVKMK 75
            ::::..::.:|.|.....|||:     :..|.|.|  |:..|..         ..|.:...|:.|
  Fly    78 WTNDDALELIEQYRCHTELWNRADPKYKDKLCRFR--AWSEIAE---------RFGCSKAEVERK 131

  Fly    76 IKNLRTGYHQELKK--IRTIPGYQPK-TPWFA 104
            :..|.|.|.:|..|  ::...|.||. :.|:|
  Fly   132 MNVLLTQYRREKHKMFVKIYQGIQPNPSKWYA 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30403NP_726108.3 GT1 24..103 CDD:304916 21/86 (24%)
CG5953NP_001260503.1 MADF_DNA_bdg 86..170 CDD:287510 23/89 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21505
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.