DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30403 and CG4004

DIOPT Version :10

Sequence 1:NP_726108.3 Gene:CG30403 / 246595 FlyBaseID:FBgn0050403 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_727638.2 Gene:CG4004 / 32226 FlyBaseID:FBgn0030418 Length:359 Species:Drosophila melanogaster


Alignment Length:211 Identity:51/211 - (24%)
Similarity:76/211 - (36%) Gaps:51/211 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KFVELYGREPCLWNKRPYLRRARS---AAYRRIQSGINADIEPYESGLTIQGVKMKIKNLRTGYH 84
            ||:.||...|.||..|..|.|.|.   .:|.|:...:...    :|...|..:|.||.|.||.|.
  Fly    13 KFLGLYRSMPELWLVRSKLYRDRQLKLESYSRLLELLRTT----DSYANIHTLKRKINNFRTSYR 73

  Fly    85 QELKKIRTIPGYQPKTPWFAPLHGFLAEFLDTNELE--------------------------TSI 123
            :||:|:.........|.|:.....||.| |:|.||:                          |..
  Fly    74 RELRKVLDSGNTYKPTLWYFKELDFLYE-LETGELQLEGIVAADRDLVRNSKVLQNESNKTITFG 137

  Fly   124 PQLKRLQIRLTRL--KPIKIQTEIKPDPDDLSVPDRPLDATPSSLFTVLPAPMPVEEPPTPPPSV 186
            .||...::.::.:  :.|::...|..|...|...|          ..::....|.||...   .:
  Fly   138 AQLAEQEVSMSFIVKREIEVDENITEDMQQLETED----------VDIMSDAFPHEEDML---RL 189

  Fly   187 PKIGDIISPVHPDPAP 202
            ..:||  ..|.|:|.|
  Fly   190 DAVGD--GDVEPEPEP 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30403NP_726108.3 MADF_DNA_bdg 24..103 CDD:463144 25/81 (31%)
CG4004NP_727638.2 MADF_DNA_bdg 14..99 CDD:463144 26/88 (30%)

Return to query results.
Submit another query.