DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30403 and CG5180

DIOPT Version :9

Sequence 1:NP_726108.3 Gene:CG30403 / 246595 FlyBaseID:FBgn0050403 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001138087.1 Gene:CG5180 / 192508 FlyBaseID:FBgn0043457 Length:355 Species:Drosophila melanogaster


Alignment Length:367 Identity:67/367 - (18%)
Similarity:124/367 - (33%) Gaps:110/367 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FSDERTVKFVELYGREPCLWNKR--PYLRR-ARSAAYRRIQSGINADIEPY-ESGLTIQGVKMKI 76
            :|.....:|:|.|..|.|||..:  .|... ||:.:|.|:...:. ::||. :..:.::    ||
  Fly     8 YSRHWLTEFIEQYQEEECLWQPKHNDYSNHTARNKSYDRLVEKLK-EVEPNPDRAMVVR----KI 67

  Fly    77 KNLRTGYHQELKKIRTIPGYQPKTPWFAPLHGFLAEFLDTNELETSIPQLKRLQIRLTRLKPIKI 141
            .:||:.:.:|.:|..|...|..:. |:.....|:|:..         |:...|..:..|...|..
  Fly    68 NSLRSAFRREFRKTSTKGDYATRL-WYYDKLLFIADHK---------PKRHELGSKPKRELHISF 122

  Fly   142 QTEIKPDPDDLSVPDRPLDATPSS-LFTVLP-APMPVEEPPTPPPS--VPKIGDIISPVHPDPAP 202
            ..|...:.:|    |.....|.|. :.:::| :|..|||......:  |...|..:|.:...||.
  Fly   123 DDEESMEFED----DSHHTGTQSQHMESIIPTSPDDVEEVAATANNVVVSSQGATLSTISVTPAE 183

  Fly   203 ---------------------------VPIAGNCPLSTACSISEKSEVLGLGLGVSAAGR----- 235
                                       ...|....::.|.:.....:||.:....|.:.|     
  Fly   184 CVTLVKSEEHQAAEAAAAAAQAHQQMVAHAAAQTSIAAAAAQGHAVKVLEITSLDSNSQREIQQA 248

  Fly   236 ---------------TNGVGLGV------------------------------EMRGEDEFTYFG 255
                           |||...||                              ..|.:||:...|
  Fly   249 VNHLEHHQQQLHLQQTNGQHQGVPTIQIGRDHYQPLFGNAGTTAYTTTAATSTSHRQDDEYDAIG 313

  Fly   256 LSVAAQIRNMPLASAMLMQSKIQYMLSMERRKINGHPGDMDI 297
            ::||:::|::.....::.:..|..:|      .|...|::.:
  Fly   314 VNVASKLRSINPTQRIVAEKLISDVL------FNAQLGNLTV 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30403NP_726108.3 GT1 24..103 CDD:304916 22/82 (27%)
CG5180NP_001138087.1 MADF_DNA_bdg 16..100 CDD:287510 23/89 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009991
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21505
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.