DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dany and dan

DIOPT Version :9

Sequence 1:NP_726137.2 Gene:dany / 246593 FlyBaseID:FBgn0050401 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001262948.1 Gene:dan / 43023 FlyBaseID:FBgn0039286 Length:781 Species:Drosophila melanogaster


Alignment Length:64 Identity:30/64 - (46%)
Similarity:43/64 - (67%) Gaps:2/64 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RGKRPRVQVSLDDKERAIARIRGGETKAGISRELGVPESTVRGWVKRAEQRLARETTSQTGSAN 71
            :||||...::..||..||.||..||:||.::|::||||||:|||.|. |.:| |..:.|:.:.|
  Fly     8 KGKRPLRSLTPRDKIHAIQRIHDGESKASVARDIGVPESTLRGWCKN-EDKL-RFMSRQSATDN 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
danyNP_726137.2 HTH 10..60 CDD:304362 25/49 (51%)
sigma70-ECF <17..62 CDD:274357 23/44 (52%)
danNP_001262948.1 CENP-B_N 10..62 CDD:282122 27/53 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10997
eggNOG 1 0.900 - - E1_2DCHB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012693
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.