powered by:
Protein Alignment dany and dan
DIOPT Version :9
Sequence 1: | NP_726137.2 |
Gene: | dany / 246593 |
FlyBaseID: | FBgn0050401 |
Length: | 275 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001262948.1 |
Gene: | dan / 43023 |
FlyBaseID: | FBgn0039286 |
Length: | 781 |
Species: | Drosophila melanogaster |
Alignment Length: | 64 |
Identity: | 30/64 - (46%) |
Similarity: | 43/64 - (67%) |
Gaps: | 2/64 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 RGKRPRVQVSLDDKERAIARIRGGETKAGISRELGVPESTVRGWVKRAEQRLARETTSQTGSAN 71
:||||...::..||..||.||..||:||.::|::||||||:|||.|. |.:| |..:.|:.:.|
Fly 8 KGKRPLRSLTPRDKIHAIQRIHDGESKASVARDIGVPESTLRGWCKN-EDKL-RFMSRQSATDN 69
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
56 |
1.000 |
Domainoid score |
I10997 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2DCHB |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0012693 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.900 |
|
Return to query results.
Submit another query.