DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30398 and mitd1

DIOPT Version :9

Sequence 1:NP_726113.1 Gene:CG30398 / 246591 FlyBaseID:FBgn0050398 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001004902.1 Gene:mitd1 / 448256 XenbaseID:XB-GENE-5755252 Length:245 Species:Xenopus tropicalis


Alignment Length:225 Identity:74/225 - (32%)
Similarity:119/225 - (52%) Gaps:13/225 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ALKCEQTGHIMEAILLYEESIFKLSQMA-----DAEPSR-RQLCGKYL-KMYEARAKQLRDQVKG 81
            |::.:..|...|:::.|:|.|..|.|:.     ||:.:. ||....|: :..|.:...|:::.:|
 Frog    18 AVELDGKGRYQESLVCYQEGIELLLQVLKGTKDDAKKTHYRQKLSSYMDRAEEIKQHVLKEKEEG 82

  Fly    82 HLHTSRMLDHITIEQGARGRSYQRLFGPYLDDAVREAHLNEPHLTEPPHFRNLLNFFEVLVKNCR 146
            ..|     ..|.|.:.|.|.||:.||.||:::.:.|..:.:|::.......|.|.|.|:|:|...
 Frog    83 KYH-----KQIKIVENATGYSYENLFKPYVNETLTEVWVEDPYIRYVHQLYNFLRFCEMLIKGPS 142

  Fly   147 YLKYIRLTTRPDATAPK-NQLQMLQQMQSDLAGGNIQMNFQMDDSLHDRKIVLSSGVVIKIGRGL 210
            .:|.|.|.|..|....| .|...||:::|.|....:.:......|:|||:|..::|.:|||||||
 Frog   143 KVKKINLLTSMDEDNGKAQQASGLQEIKSSLQDYGVILEVTFSSSIHDREIRFNNGWMIKIGRGL 207

  Fly   211 HYFEPMEGSYSLGLCDFDFRKCLATEVDIW 240
            .||:..:|.:|:|.||||.|.|..|.|||:
 Frog   208 DYFKKPQGRFSIGYCDFDLRPCYETSVDIF 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30398NP_726113.1 MIT 13..83 CDD:294211 16/65 (25%)
MIT_C 97..244 CDD:239148 55/145 (38%)
mitd1NP_001004902.1 MIT_1 6..82 CDD:239146 15/63 (24%)
MIT_C 96..238 CDD:379859 54/142 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 103 1.000 Domainoid score I6714
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4187
OMA 1 1.010 - - QHG48951
OrthoDB 1 1.010 - - D1494805at2759
OrthoFinder 1 1.000 - - FOG0006049
OrthoInspector 1 1.000 - - otm49114
Panther 1 1.100 - - O PTHR21222
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4343
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.080

Return to query results.
Submit another query.