DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30398 and mitd1

DIOPT Version :9

Sequence 1:NP_726113.1 Gene:CG30398 / 246591 FlyBaseID:FBgn0050398 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_956495.2 Gene:mitd1 / 393170 ZFINID:ZDB-GENE-040426-923 Length:246 Species:Danio rerio


Alignment Length:247 Identity:77/247 - (31%)
Similarity:126/247 - (51%) Gaps:35/247 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LPKLE-AIISALK----CEQTGHIMEAILLYEESIFKLSQMADAEPSRRQLCGKYLKMYEARAKQ 74
            ||.:| :.:|.||    .:......||::.|:|.|              ||....||..:..||:
Zfish     6 LPGVESSAVSVLKRAVQLDNCSRFQEALVCYQEGI--------------QLLLDVLKAVKDEAKK 56

  Fly    75 L--RDQVKGHL--------HTSRML------DHITIEQGARGRSYQRLFGPYLDDAVREAHLNEP 123
            :  |:::||::        ||:::.      :.|.|...:.|.||:.||.||:.|.:.|..:.:|
Zfish    57 MHYREKIKGYMERAEQIKEHTTKLKEEGKYHEQIKIADSSTGYSYESLFKPYITDGLTEVWVEDP 121

  Fly   124 HLTEPPHFRNLLNFFEVLVKNCRYLKYIRLTTRPDATAPKNQLQMLQQMQSDLAGGNIQMNFQMD 188
            ::.......|.|.|.|:|:|....:|.|.|.|..|..:...|...|.:|:..|...:|.::.|..
Zfish   122 YVRHVHQLYNFLRFCEMLLKCPSTVKTIHLLTSQDEDSSTQQSSALAEMKQSLLSKDICLDIQYS 186

  Fly   189 DSLHDRKIVLSSGVVIKIGRGLHYFEPMEGSYSLGLCDFDFRKCLATEVDIW 240
            .::|||:|..::|.:|||||||.||:..:|.:|:|.||:|.|:|..|.|||:
Zfish   187 STIHDREIRFNNGWIIKIGRGLDYFKKPKGRFSVGYCDYDLRECHETTVDIF 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30398NP_726113.1 MIT 13..83 CDD:294211 20/74 (27%)
MIT_C 97..244 CDD:239148 53/144 (37%)
mitd1NP_956495.2 MIT_1 8..84 CDD:239146 20/89 (22%)
MIT_C 98..239 CDD:318714 53/141 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580617
Domainoid 1 1.000 106 1.000 Domainoid score I6504
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I4331
OMA 1 1.010 - - QHG48951
OrthoDB 1 1.010 - - D1494805at2759
OrthoFinder 1 1.000 - - FOG0006049
OrthoInspector 1 1.000 - - otm26599
orthoMCL 1 0.900 - - OOG6_106548
Panther 1 1.100 - - O PTHR21222
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4343
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.