DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30392 and PLEKHA8

DIOPT Version :10

Sequence 1:NP_611572.2 Gene:CG30392 / 246587 FlyBaseID:FBgn0050392 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001183955.1 Gene:PLEKHA8 / 84725 HGNCID:30037 Length:519 Species:Homo sapiens


Alignment Length:207 Identity:54/207 - (26%)
Similarity:94/207 - (45%) Gaps:28/207 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ETSLLDEDDVQLDAYLAAYEEIMKFFQLMG-SVFSFVSSDVRSKIDILYALRAKDAEEQEHFNTF 93
            :..||::..:..:|:||:...::.....:| :||:.|..|:...|.   .:..|....:|.|.|.
Human   321 DIELLEDSGIPTEAFLASCYAVVPVLDKLGPTVFAPVKMDLVGNIK---KVNQKYITNKEEFTTL 382

  Fly    94 RTMLDYEKEAQLLTQKGYVSGSRTLLRLHRGLDFVYEFLNRIQAIPDDQKTVDVCKEAYDDTLGK 158
            :.::.:|.||.:...:.  |.:..||.|.|||.|:..||..::....|.:|  ....||..||.:
Human   383 QKIVLHEVEADVAQVRN--SATEALLWLKRGLKFLKGFLTEVKNGEKDIQT--ALNNAYGKTLRQ 443

  Fly   159 HHSFLIRKGARLAMYAMPTRGDLLKKV-CSDVEAAKE------------NLPSMLKHMRTNYDRT 210
            ||.:::|....||:.|.|:..|.:..: ..:.:..||            .||:|.|.:..     
Human   444 HHGWVVRGVFALALRAAPSYEDFVAALTVKEGDHQKEAFSIGMQRDLSLYLPAMEKQLAI----- 503

  Fly   211 EDLYTLYDLHSL 222
              |.|||::|.|
Human   504 --LDTLYEVHGL 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30392NP_611572.2 GLTP 39..183 CDD:462575 40/144 (28%)
PLEKHA8NP_001183955.1 PH_FAPP1_FAPP2 1..100 CDD:269951
Glycolipid transfer protein homology domain 310..519 54/207 (26%)
GLTP 330..468 CDD:462575 40/144 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.