DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30392 and ACD11

DIOPT Version :10

Sequence 1:NP_611572.2 Gene:CG30392 / 246587 FlyBaseID:FBgn0050392 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_181016.1 Gene:ACD11 / 818034 AraportID:AT2G34690 Length:206 Species:Arabidopsis thaliana


Alignment Length:199 Identity:59/199 - (29%)
Similarity:88/199 - (44%) Gaps:20/199 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KVSNLFETSLL----DEDDVQLDAYLAAYEEIMKFFQLMGSVFSFVSSDVRSKIDILYALRAKDA 84
            |:|..|:...:    ...:|.:..:..|...:...|..:|..|.|...|..:|:|.|  :||..:
plant    12 KISAAFKKLAIIVNSPNPEVPVTQFSHACSLVSPLFGCLGIAFKFAEMDYVAKVDDL--VRASSS 74

  Fly    85 EEQEHFNTFRTMLDYEKEAQLLTQKGYVSGSRTLLRLHRGLDFVYEFLNRIQAIPDDQKTVDVCK 149
                 .:|...|:|.:.||..:.:.|  |.:|.|||:.||||.|.....:|.|...|....|...
plant    75 -----ISTLVVMMDKDIEADCVRKAG--SHTRNLLRVKRGLDMVKVLFEQIIASEGDNSLKDPAT 132

  Fly   150 EAYDDTLGKHHSFLIRKGARLAMYAMPTRGDLLKKVCSDVEAAKENLPSMLKHMRTNYDRTEDLY 214
            ::|......||.:.|||...|.|||:|||..||..:..|..|||       .||::..:.:..|.
plant   133 KSYAQVFAPHHGWAIRKAVSLGMYALPTRAHLLNMLKEDEAAAK-------IHMQSYVNSSAPLI 190

  Fly   215 TLYD 218
            |..|
plant   191 TYLD 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30392NP_611572.2 GLTP 39..183 CDD:462575 46/143 (32%)
ACD11NP_181016.1 GLTP 31..166 CDD:462575 46/143 (32%)

Return to query results.
Submit another query.