DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30392 and Cptp

DIOPT Version :9

Sequence 1:NP_001286672.1 Gene:CG30392 / 246587 FlyBaseID:FBgn0050392 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_077792.2 Gene:Cptp / 79554 MGIID:1933107 Length:216 Species:Mus musculus


Alignment Length:211 Identity:69/211 - (32%)
Similarity:121/211 - (57%) Gaps:9/211 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 FDILKVSNLFETSLLDEDDVQLDAYLAAYEEIMKFFQLMGSVFSFVSSDVRSKIDILYALRAKDA 84
            |::..|...|:..|.|:.:|.||.|:|.::.:::|...:|:||||:|.||.:|:.|:..||:  :
Mouse     8 FNLKVVLVSFKQCLTDKGEVLLDHYIAGWKGLVRFLNSLGAVFSFISKDVVAKLQIMERLRS--S 70

  Fly    85 EEQEHFNTFRTMLDYEKEAQLLTQ------KGYVSGSRTLLRLHRGLDFVYEFLNRIQAIPDDQK 143
            .:.||:.:.::|:.||...:|:..      :...||.||:|||||.|.::..||:.::...:|.:
Mouse    71 PQSEHYASLQSMVAYEVSNKLVDMDHRSHPRHPHSGCRTVLRLHRALHWLQLFLDGLRTSSEDAR 135

  Fly   144 TVDVCKEAYDDTLGKHHSFLIRKGARLAMYAMPTRGDLLKKV-CSDVEAAKENLPSMLKHMRTNY 207
            |..:|.|||:.||..:||:::|:...:|..|:|:|...|:.: ....|.|.|.|...|..:...|
Mouse   136 TSTLCSEAYNATLANYHSWIVRQAVTVAFCALPSRKVFLEAMNMESTEQAVEMLGEALPFIEHVY 200

  Fly   208 DRTEDLYTLYDLHSLP 223
            |.::.||..:.|..||
Mouse   201 DISQKLYAEHSLLDLP 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30392NP_001286672.1 GLTP 42..186 CDD:285880 50/150 (33%)
CptpNP_077792.2 GLTP 30..178 CDD:285880 50/149 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 98 1.000 Domainoid score I7194
eggNOG 1 0.900 - - E1_KOG4189
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11550
Inparanoid 1 1.050 117 1.000 Inparanoid score I4800
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49248
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002959
OrthoInspector 1 1.000 - - otm43391
orthoMCL 1 0.900 - - OOG6_104617
Panther 1 1.100 - - O PTHR10219
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3093
SonicParanoid 1 1.000 - - X1338
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.