DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30392 and F49D11.10

DIOPT Version :9

Sequence 1:NP_001286672.1 Gene:CG30392 / 246587 FlyBaseID:FBgn0050392 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001122480.2 Gene:F49D11.10 / 6418594 WormBaseID:WBGene00045433 Length:727 Species:Caenorhabditis elegans


Alignment Length:108 Identity:19/108 - (17%)
Similarity:45/108 - (41%) Gaps:24/108 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 SVFSFVSSDVRSKIDILYALRAKDAEEQEHFNTFRTMLDYEKEAQLLTQKGYVSGSRTLLRLHRG 124
            ||:.:...|||..::     |:::.:|.|    .|::.:.:.:.:.::    ..|...:|...:.
 Worm   479 SVWDYTEKDVREDLE-----RSRNWQEAE----IRSISNIQADGKFVS----AHGQHAVLWNVKN 530

  Fly   125 LDFVYEFLNRIQAIPDDQKTVDVCKEAYDDTLGKHHSFLIRKG 167
            :..:     .:.:..||..:||...:      |:|.....:||
 Worm   531 MKII-----DVLSCSDDIISVDFAAD------GRHLIISTKKG 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30392NP_001286672.1 GLTP 42..186 CDD:285880 19/108 (18%)
F49D11.10NP_001122480.2 WD40 148..577 CDD:225201 19/108 (18%)
WD40 <395..556 CDD:295369 17/100 (17%)
WD40 repeat 455..496 CDD:293791 6/21 (29%)
WD40 repeat 503..537 CDD:293791 3/42 (7%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4189
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.