DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30392 and gltpd2b

DIOPT Version :9

Sequence 1:NP_001286672.1 Gene:CG30392 / 246587 FlyBaseID:FBgn0050392 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001313415.1 Gene:gltpd2b / 565337 ZFINID:ZDB-GENE-060526-346 Length:299 Species:Danio rerio


Alignment Length:264 Identity:80/264 - (30%)
Similarity:120/264 - (45%) Gaps:51/264 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SLATQTNGTAENGNC----FDILKVSNLFETSLLDEDDVQLDAYLAAYEEIMKFFQLMGSVFSFV 65
            ||.|.....|....|    |.|..:....:.:.|..:||.|..|||:::|::||.:.:|.:...:
Zfish    42 SLVTDNTSDAPLSVCPDQSFQIAYLLAHLQAAPLAANDVLLKPYLASWDELIKFLEALGPIVGII 106

  Fly    66 SSDVRSKIDILYALRAKDAEEQEH------------------------------FNTFRTMLDYE 100
            |.::.||..|:..| |:.|||:|.                              :.:.|:|:..|
Zfish   107 SQEIESKTTIIRDL-AQKAEEEEKKMIERKETTKQLAQSKSSNYSKMDQTLSSGYTSVRSMIKME 170

  Fly   101 KEAQLL---TQKGYVSGSRTLLRLHRGLDFVYEFLNRI-------QAIPDDQKTVDVCKEAYDDT 155
            .|..|:   ||..  ||.||||||||.|.::..||:.:       :.:   ::..|:|||.|..|
Zfish   171 LENGLVDFQTQTN--SGCRTLLRLHRALLWLQNFLHELGKDVAKGERL---RRPSDLCKETYQRT 230

  Fly   156 LGKHHSFLIRKGARLAMYAMPTRGDLLKKVCSDVEA-AKENLPSMLKHMRTNYDRTEDLYTLYDL 219
            |.:|||:..||.|.||..|||.|....|.||...:| |...|..::|.:...|.|.|.....:|:
Zfish   231 LARHHSWWARKAAELAFLAMPERSYFYKLVCVKTQAEASVVLNRVVKAIEKVYKRNEVALQEHDM 295

  Fly   220 HSLP 223
            ..||
Zfish   296 LDLP 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30392NP_001286672.1 GLTP 42..186 CDD:285880 57/183 (31%)
gltpd2bNP_001313415.1 GLTP 83..262 CDD:285880 58/184 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582027
Domainoid 1 1.000 102 1.000 Domainoid score I6807
eggNOG 1 0.900 - - E1_KOG4189
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1423493at2759
OrthoFinder 1 1.000 - - FOG0002959
OrthoInspector 1 1.000 - - otm24675
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10219
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1338
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.810

Return to query results.
Submit another query.