DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30392 and cptp

DIOPT Version :9

Sequence 1:NP_001286672.1 Gene:CG30392 / 246587 FlyBaseID:FBgn0050392 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001008043.1 Gene:cptp / 493405 XenbaseID:XB-GENE-974130 Length:215 Species:Xenopus tropicalis


Alignment Length:210 Identity:68/210 - (32%)
Similarity:120/210 - (57%) Gaps:8/210 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 FDILKVSNLFETSLLDED-DVQLDAYLAAYEEIMKFFQLMGSVFSFVSSDVRSKIDILYALRAKD 83
            |.:.:|...|::.|:|:| |:.::.||..::.:::|...:|::|||||.|..:||.|:....|  
 Frog     8 FSLKEVLVSFKSCLVDDDQDIIVEQYLNGWKGLVRFMNSLGTIFSFVSKDAVTKIQIMENYLA-- 70

  Fly    84 AEEQEHFNTFRTMLDYEKEAQL--LTQK--GYVSGSRTLLRLHRGLDFVYEFLNRIQAIPDDQKT 144
            ....|.:.|.::|:::|..:.|  ||::  ...||.||:|||||.|.::..||.:::...:|.||
 Frog    71 GTNGERYRTLQSMVEHELSSDLVDLTKRCNNPDSGCRTILRLHRALRWLQLFLEKLRTSNEDSKT 135

  Fly   145 VDVCKEAYDDTLGKHHSFLIRKGARLAMYAMPTRGDLLKKV-CSDVEAAKENLPSMLKHMRTNYD 208
            ..:|.|||:|:|...|.::|||.|.:|..|:|||....:.: ....|.....|...:.::...||
 Frog   136 STLCTEAYNDSLANFHPWIIRKTATVAFLALPTRNTFFEVMNVGTTEEVVAMLGESMPYVTKVYD 200

  Fly   209 RTEDLYTLYDLHSLP 223
            .|.::|:.::|..||
 Frog   201 FTHEIYSQHNLLELP 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30392NP_001286672.1 GLTP 42..186 CDD:285880 52/148 (35%)
cptpNP_001008043.1 GLTP 31..177 CDD:370081 52/147 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 100 1.000 Domainoid score I6918
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11550
Inparanoid 1 1.050 115 1.000 Inparanoid score I4680
OMA 1 1.010 - - QHG49248
OrthoDB 1 1.010 - - D1423493at2759
OrthoFinder 1 1.000 - - FOG0002959
OrthoInspector 1 1.000 - - otm48534
Panther 1 1.100 - - O PTHR10219
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3093
SonicParanoid 1 1.000 - - X1338
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.