DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30392 and GLTPD2

DIOPT Version :10

Sequence 1:NP_611572.2 Gene:CG30392 / 246587 FlyBaseID:FBgn0050392 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001362730.1 Gene:GLTPD2 / 388323 HGNCID:33756 Length:327 Species:Homo sapiens


Alignment Length:200 Identity:70/200 - (35%)
Similarity:101/200 - (50%) Gaps:22/200 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 FETSLLDEDDVQLDAYLAAYEEIMKFFQLMGSVFSFVSSDVRSKI-DILYALRAKDAEEQEHFNT 92
            |..||..|.||.|..|||.:..:::|...:||||:|.:.:..:|: |:...:...||   ||:.:
Human   125 FHASLKPEGDVGLSPYLAGWRALVEFLTPLGSVFAFATREAFTKVTDLEARVHGPDA---EHYWS 186

  Fly    93 FRTMLDYEKEAQLLTQKGYV-------SGSRTLLRLHRGLDFVYEFLNRIQ--AIPDDQKTVDVC 148
            ...|..:|:.|.||.|.|..       |||||||.|||.|.:....|:|:.  |:......|. |
Human   187 LVAMAAWERRAGLLEQPGAAPRDPTRSSGSRTLLLLHRALRWSQLCLHRVATGALGGPDAGVQ-C 250

  Fly   149 KEAYDDTLGKHHSFLIRKGARLAMYAMPTRGDLLKKVC-----SDVEAAKENLPSMLKHMRTNYD 208
            .:||...||.||.:|:|:.||||..|.|.|..||:..|     ::..||.......|:.:   |:
Human   251 SDAYRAALGPHHPWLVRQTARLAFLAFPGRRRLLELACPGATEAEARAALVRAAGTLEDV---YN 312

  Fly   209 RTEDL 213
            ||:.|
Human   313 RTQSL 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30392NP_611572.2 GLTP 39..183 CDD:462575 56/153 (37%)
GLTPD2NP_001362730.1 GLTP 135..285 CDD:462575 56/153 (37%)

Return to query results.
Submit another query.