DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30392 and Cptp

DIOPT Version :9

Sequence 1:NP_001286672.1 Gene:CG30392 / 246587 FlyBaseID:FBgn0050392 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001007704.1 Gene:Cptp / 313771 RGDID:1359656 Length:216 Species:Rattus norvegicus


Alignment Length:211 Identity:70/211 - (33%)
Similarity:119/211 - (56%) Gaps:9/211 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 FDILKVSNLFETSLLDEDDVQLDAYLAAYEEIMKFFQLMGSVFSFVSSDVRSKIDILYALRAKDA 84
            |::..|...|:..|.|:.:|.||.|.|:::.:::|...:|:||||:|.||.||:.|:..||:  .
  Rat     8 FNLKVVLISFKKCLTDKGEVLLDHYTASWKGLVRFLNSLGAVFSFISKDVVSKLQIMEHLRS--G 70

  Fly    85 EEQEHFNTFRTMLDYEKEAQLLTQKGYV------SGSRTLLRLHRGLDFVYEFLNRIQAIPDDQK 143
            .:.||:.:.::|:.||...:|:.:....      ||.||:|||||.|.::..||..::...:|.:
  Rat    71 PQSEHYISLQSMVAYEVSNKLVDRDSRSRPRHPNSGCRTVLRLHRALHWLQLFLEGLRTSSEDAR 135

  Fly   144 TVDVCKEAYDDTLGKHHSFLIRKGARLAMYAMPTRGDLLKKV-CSDVEAAKENLPSMLKHMRTNY 207
            |..:|.|||:.||..:||:::|:...:|.:|:|.|...|:.: ....|.|.|.|...|..:...|
  Rat   136 TSTLCSEAYNATLAAYHSWIVRQAVNVAFHALPPRKVFLEAMNMGSSEQAVEMLGEALPFIEQVY 200

  Fly   208 DRTEDLYTLYDLHSLP 223
            |.::.||..:.|..||
  Rat   201 DISQKLYAEHSLLDLP 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30392NP_001286672.1 GLTP 42..186 CDD:285880 51/150 (34%)
CptpNP_001007704.1 GLTP 30..175 CDD:400867 50/146 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 99 1.000 Domainoid score I6930
eggNOG 1 0.900 - - E1_KOG4189
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11550
Inparanoid 1 1.050 117 1.000 Inparanoid score I4712
OMA 1 1.010 - - QHG49248
OrthoDB 1 1.010 - - D1423493at2759
OrthoFinder 1 1.000 - - FOG0002959
OrthoInspector 1 1.000 - - oto97101
orthoMCL 1 0.900 - - OOG6_104617
Panther 1 1.100 - - O PTHR10219
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1338
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.