DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30392 and CERT1

DIOPT Version :10

Sequence 1:NP_611572.2 Gene:CG30392 / 246587 FlyBaseID:FBgn0050392 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001123577.1 Gene:CERT1 / 10087 HGNCID:2205 Length:752 Species:Homo sapiens


Alignment Length:214 Identity:43/214 - (20%)
Similarity:77/214 - (35%) Gaps:75/214 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LDEDDVQLDAYLAAY-------EEIMKFFQLMGSVFSFVSSDVRSKIDILYALRAKDAEEQ-EHF 90
            ::|:.:.||...|.:       .|:..:|.         :.|||:           |.|.. |:|
Human   562 VEENGIVLDPLKATHAVKGVTGHEVCNYFW---------NVDVRN-----------DWETTIENF 606

  Fly    91 NTFRTMLDYEKEAQLLTQ---KGYVSGSRTLLRLHRGLDFVYEFLNRIQAIP----DDQKTVDVC 148
            :...|:.|   .|.::.|   :.:.:..|.:|           :|:.|:.||    :|.:|..||
Human   607 HVVETLAD---NAIIIYQTHKRVWPASQRDVL-----------YLSVIRKIPALTENDPETWIVC 657

  Fly   149 KEAYDDTLGKHHSFLIRKGARLAMYAMP-----------TRGDLLKKV-------------CSDV 189
            ..:.|......::..:|....:||....           :|.::|.|:             .|.:
Human   658 NFSVDHDSAPLNNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVL 722

  Fly   190 EA-AKENLPSMLKHMRTNY 207
            .| ||...|..||.. |:|
Human   723 RAVAKREYPKFLKRF-TSY 740

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30392NP_611572.2 GLTP 39..183 CDD:462575 31/169 (18%)
CERT1NP_001123577.1 PH_GPBP 154..253 CDD:270100
START_STARD11-like 519..752 CDD:176881 43/214 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.