DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30392 and gltpd2

DIOPT Version :9

Sequence 1:NP_001286672.1 Gene:CG30392 / 246587 FlyBaseID:FBgn0050392 Length:223 Species:Drosophila melanogaster
Sequence 2:XP_002940711.2 Gene:gltpd2 / 100490446 XenbaseID:XB-GENE-994824 Length:298 Species:Xenopus tropicalis


Alignment Length:216 Identity:72/216 - (33%)
Similarity:119/216 - (55%) Gaps:12/216 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 NC----FDILKVSNLFETSLLDEDDVQLDAYLAAYEEIMKFFQLMGSVFSFVSSDVRSKIDILYA 78
            ||    |.|.::...|...:.::.|:.|:.||.|:.:::||...:|:||:|:||:..:|::||..
 Frog    85 NCKQHEFQIGRMVEAFRYCMTEKKDILLEEYLIAWRQLIKFMDALGTVFTFISSETMTKVNILQG 149

  Fly    79 LRAKDAEEQEHFNTFRTMLDYEKEAQLLTQK-----GYVSGSRTLLRLHRGLDFVYEFLNRIQAI 138
            .  .:.|..:.:.|..:|:.||.|.:::..|     ...||.||||||||.|.|:..||..:...
 Frog   150 Y--LNGEHGKDYRTVTSMVKYELENEVVNFKELPPNRVPSGCRTLLRLHRALKFLEVFLYNLGMS 212

  Fly   139 PDDQKTVDVCKEAYDDTLGKHHSFLIRKGARLAMYAMPTRGDLLKKVC-SDVEAAKENLPSMLKH 202
            ....||..:|.:||..||..|||:.||:.|.:|..|:|...|:.|.|| |:.:.||..|.:.:..
 Frog   213 VGKDKTSQMCADAYHKTLSHHHSWFIRQVAEVAFLALPPIEDMYKVVCVSNHKDAKIVLLTTVDA 277

  Fly   203 MRTNYDRTEDLYTLYDLHSLP 223
            :...|:.|:::||.:.:..||
 Frog   278 IVKVYNITQEVYTKHGMLDLP 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30392NP_001286672.1 GLTP 42..186 CDD:285880 53/148 (36%)
gltpd2XP_002940711.2 GLTP 113..260 CDD:370081 53/148 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 100 1.000 Domainoid score I6918
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 115 1.000 Inparanoid score I4680
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1423493at2759
OrthoFinder 1 1.000 - - FOG0002959
OrthoInspector 1 1.000 - - otm48534
Panther 1 1.100 - - LDO PTHR10219
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3093
SonicParanoid 1 1.000 - - X1338
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1111.100

Return to query results.
Submit another query.