DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30382 and PUP1

DIOPT Version :9

Sequence 1:NP_001163078.1 Gene:CG30382 / 246582 FlyBaseID:FBgn0050382 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_014800.3 Gene:PUP1 / 854328 SGDID:S000005683 Length:261 Species:Saccharomyces cerevisiae


Alignment Length:183 Identity:47/183 - (25%)
Similarity:76/183 - (41%) Gaps:41/183 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 TTVALKSGDCAVVATQKKVTEKNIVPE-TVTHLFRITKDIGCAMTGRIADSRSQVQKARYEAANF 101
            |.|.:|..:..|:|...:.|:..||.: ....|.||:..|.||..|..||:.:..|         
Yeast    31 TIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVTQ--------- 86

  Fly   102 RYKYGYEMPVDVLCRRIADINQVYTQNAEMRPLGCSMV----LIAYDNEIGP--SVYKTDPAG-- 158
                        |.....:::.:|| :.|.|.:....:    |..|...||.  .|...||.|  
Yeast    87 ------------LIGSNIELHSLYT-SREPRVVSALQMLKQHLFKYQGHIGAYLIVAGVDPTGSH 138

  Fly   159 YFS---------GFKACSVGAKTLEANSYLEKKYKPNLSEEKAIQLAISCLSS 202
            .||         |: ..|:|:.:|.|.:.||..:|.:|::|:||:||...:.:
Yeast   139 LFSIHAHGSTDVGY-YLSLGSGSLAAMAVLESHWKQDLTKEEAIKLASDAIQA 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30382NP_001163078.1 PRE1 7..243 CDD:223711 47/183 (26%)
proteasome_alpha_type_6 8..218 CDD:239723 47/183 (26%)
PUP1NP_014800.3 proteasome_beta_type_7 30..219 CDD:239732 47/183 (26%)
Pr_beta_C 223..257 CDD:403609
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.