DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30382 and PAA1

DIOPT Version :9

Sequence 1:NP_001163078.1 Gene:CG30382 / 246582 FlyBaseID:FBgn0050382 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_198409.1 Gene:PAA1 / 833524 AraportID:AT5G35590 Length:246 Species:Arabidopsis thaliana


Alignment Length:246 Identity:140/246 - (56%)
Similarity:174/246 - (70%) Gaps:2/246 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVPET 65
            |||||.||:|||||||||||||:||||||||:....||::.::..|...|.|||||.:|.:...:
plant     1 MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKTAGITSIGVRGKDSVCVVTQKKVPDKLLDQSS 65

  Fly    66 VTHLFRITKDIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAE 130
            |||||.|||.||...||..||:||.||:||.:||.||:.||||||||:|.:.|||.:|||||:|.
plant    66 VTHLFPITKYIGLVATGITADARSLVQQARNQAAEFRFTYGYEMPVDILAKWIADKSQVYTQHAY 130

  Fly   131 MRPLGCSMVLIAYDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYK--PNLSEEKAI 193
            |||||...:::..|.|.||.:||.||||:|.|.||.|.|.|..||.::||||.|  |:.:.::.:
plant   131 MRPLGVVAMVMGVDEENGPLLYKCDPAGHFYGHKATSAGMKEQEAVNFLEKKMKENPSFTFDETV 195

  Fly   194 QLAISCLSSVLAIDFKPNGIEIGVVSKSDPTFRILDEREIEEHLTKIAEKD 244
            |.|||.|.|||..|||...||:|||...:|.||.|...|||||||.|:|:|
plant   196 QTAISALQSVLQEDFKATEIEVGVVRAENPEFRALTTEEIEEHLTAISERD 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30382NP_001163078.1 PRE1 7..243 CDD:223711 133/237 (56%)
proteasome_alpha_type_6 8..218 CDD:239723 118/211 (56%)
PAA1NP_198409.1 proteasome_alpha_type_6 8..220 CDD:239723 118/211 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 180 1.000 Domainoid score I1047
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2085
Inparanoid 1 1.050 266 1.000 Inparanoid score I942
OMA 1 1.010 - - QHG53623
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002933
OrthoInspector 1 1.000 - - otm2462
orthoMCL 1 0.900 - - OOG6_102240
Panther 1 1.100 - - O PTHR11599
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1933
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.920

Return to query results.
Submit another query.