DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha1R and PBD1

DIOPT Version :10

Sequence 1:NP_724616.1 Gene:Prosalpha1R / 246582 FlyBaseID:FBgn0050382 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_188902.1 Gene:PBD1 / 821834 AraportID:AT3G22630 Length:204 Species:Arabidopsis thaliana


Alignment Length:76 Identity:18/76 - (23%)
Similarity:25/76 - (32%) Gaps:18/76 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 PQTESTDRI---VHKHRAQYLELGICLRDCEQEVKSLSAATRKTLFQPEIPVNFTFLIPNELFPT 124
            |:.|..|.|   .|.|.:..|...:..|:.....:|.|          .||.     ..|.:.|.
plant    57 PRIELEDGIRLGCHHHSSSSLHFPVLSRESSPHRRSPS----------HIPE-----AGNSVAPP 106

  Fly   125 MPADKRRYETL 135
            .|..||...:|
plant   107 APPTKRHCRSL 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha1RNP_724616.1 proteasome_alpha_type_6 8..218 CDD:239723 18/76 (24%)
PBD1NP_188902.1 proteasome_beta_type_2 1..192 CDD:239727 18/76 (24%)

Return to query results.
Submit another query.