DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30382 and Psmb11

DIOPT Version :9

Sequence 1:NP_001163078.1 Gene:CG30382 / 246582 FlyBaseID:FBgn0050382 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_780413.1 Gene:Psmb11 / 73902 MGIID:1921152 Length:302 Species:Mus musculus


Alignment Length:118 Identity:29/118 - (24%)
Similarity:52/118 - (44%) Gaps:29/118 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 LIAYDNEIGPSVYKTDPAGYFSGFKAC------SVGAKTLEANSYLEKKYKPNLSEEKAIQLAIS 198
            |..:|:. ||:::..    |..|  .|      |||:.:..|...|::.|..:::.::|..||..
Mouse   150 LCGWDHS-GPALFYV----YSDG--TCLQGDIFSVGSGSPYAYGVLDRGYHYDMTIQEAYTLARC 207

  Fly   199 CLS-----------SVLAIDFKPNGIEIGVVSKSDP--TFRILDE-REIEEHL 237
            .::           ||.....:.:|.|  .||:||.  .:|.|.: |.:|:.|
Mouse   208 AVAHATHRDAYSGGSVDLFHVRESGWE--YVSRSDACVLYRELQKARSLEQEL 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30382NP_001163078.1 PRE1 7..243 CDD:223711 29/118 (25%)
proteasome_alpha_type_6 8..218 CDD:239723 20/94 (21%)
Psmb11NP_780413.1 20S_bact_beta 48..253 CDD:163402 26/111 (23%)
proteasome_beta_type_5 50..237 CDD:239730 20/95 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.