DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30382 and psma3

DIOPT Version :9

Sequence 1:NP_001163078.1 Gene:CG30382 / 246582 FlyBaseID:FBgn0050382 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001011257.1 Gene:psma3 / 496707 XenbaseID:XB-GENE-976787 Length:255 Species:Xenopus tropicalis


Alignment Length:258 Identity:76/258 - (29%)
Similarity:128/258 - (49%) Gaps:37/258 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GFDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVPETVTHLFRI 72
            |:|...:.|||:||::|||||.||: :.:.|.:.::..|..|...:|.|..|.....:...:|.:
 Frog     7 GYDLSASTFSPDGRVFQVEYAAKAV-ENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRIFNV 70

  Fly    73 TKDIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAEMRPLGCS 137
            .:.:|.|:.|.:||:||....||.||:|||..|||::|:..|..|:|.....||..:.:||.|||
 Frog    71 DRHVGMAVAGLLADARSLADIAREEASNFRANYGYDIPLKHLSDRVAMYVHAYTLYSAVRPFGCS 135

  Fly   138 MVLIAYDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKPNLS-------------- 188
            .:|.:|:.:.|..:|..||:|...|:..|::|.....|.:.:||....:::              
 Frog   136 FMLGSYNEDDGAQLYMVDPSGISYGYWGCAIGKAKQAAKTEIEKLQMKDMTCRDVVKEVAKIIYI 200

  Fly   189 -----EEKAIQLAISCLSSVLAIDFKPNGIEIGVVSKSDPTFRILDEREIEEHLTK--IAEKD 244
                 ::|:.:|.:|.:..:      .|| :..:|.|        |.||..|...|  :.|:|
 Frog   201 VHDEVKDKSFELELSWVGKI------TNG-KHEIVPK--------DIREEAEKYAKESLEEED 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30382NP_001163078.1 PRE1 7..243 CDD:223711 74/255 (29%)
proteasome_alpha_type_6 8..218 CDD:239723 67/228 (29%)
psma3NP_001011257.1 proteasome_alpha_type_3 5..217 CDD:239720 65/210 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.