DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30382 and psmb1

DIOPT Version :9

Sequence 1:NP_001163078.1 Gene:CG30382 / 246582 FlyBaseID:FBgn0050382 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001003889.1 Gene:psmb1 / 445413 ZFINID:ZDB-GENE-040618-2 Length:237 Species:Danio rerio


Alignment Length:217 Identity:47/217 - (21%)
Similarity:92/217 - (42%) Gaps:35/217 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VEYAFKAIAQENITTVALKSGDCAVVATQKKVTE-KNIVPETVTHLFRITKD--IGCAMTGRIAD 86
            ||:.|...|....|.:|:...|.|:||:..:::| .:|........:::|..  :||  :|...|
Zfish    22 VEHKFSPYAFNGGTVLAVAGEDFAIVASDTRLSEGYSIHSRDSPKCYKLTDTTVLGC--SGFHGD 84

  Fly    87 --SRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAEMRPLGCSMVLIAYDNEIGP 149
              :.:::.:||.:.  :::.....|....:...::.|  :|  .....|.....::...|.|...
Zfish    85 CLTLTKIIEARLKM--YKHSNNKSMTSGAIAAMLSTI--LY--GRRFFPYYVYNIIGGLDEEGRG 143

  Fly   150 SVYKTDPAG------YFSGFKACS---------VGAKTLEANSYLEKKYKPNLSEEKAIQLAISC 199
            :||..||.|      |.:|..|.:         :|.|.:|...::.      |::|||:||....
Zfish   144 AVYSFDPVGSYQRDTYKAGGSASAMLQPLLDNQIGFKNMENVEHVP------LTQEKAVQLVKDV 202

  Fly   200 LSSVLAID-FKPNGIEIGVVSK 220
            ..|....| :..:.:::.:|||
Zfish   203 FISAAERDVYTGDALKVCIVSK 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30382NP_001163078.1 PRE1 7..243 CDD:223711 47/217 (22%)
proteasome_alpha_type_6 8..218 CDD:239723 44/213 (21%)
psmb1NP_001003889.1 PRE1 22..237 CDD:223711 47/217 (22%)
proteasome_beta_type_1 26..237 CDD:239726 45/213 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.